themetix logo   THEMETIX | themes & sites

WordPress site example lewisvilletrafficticketlawyer.com

lewisvilletrafficticketlawyer.com | Website screenshot, Detected themes and WordPress plugins

The information update date: 05-05-2024

Installed WordPress theme:

    Inovado
    2 081 sites built with Inovado theme | Approximate price $59

    Installed next WordPress plugins:

    • Contact Form 7
      726 035  sites built with Contact Form 7 plugin
    • Flexslider
      1 225  sites built with Flexslider plugin
    • Revolution Slider
      373 732  sites built with Revolution Slider plugin | Approximate price $31

    Domain name zone


    The collection of websites with UK domain names. Explore this curated list of diverse wordpress websites with COM-specific web addresses.
    Free checker of available COM domain names for purchasing