WordPress site example lewisvilletrafficticketlawyer.com
lewisvilletrafficticketlawyer.com | Website screenshot, Detected themes and WordPress plugins
The information update date: 05-05-2024
Installed WordPress theme:
-
Contact Form 7
726 035 sites built with Contact Form 7 plugin -
Flexslider
1 225 sites built with Flexslider plugin -
Revolution Slider
373 732 sites built with Revolution Slider plugin | Approximate price $31
Inovado
2 081 sites built with Inovado theme | Approximate price $59Installed next WordPress plugins:
Domain name zone
The collection of websites with UK domain names.
Explore this curated list of diverse wordpress websites with COM-specific web addresses.
Free checker of available COM domain names for purchasing